PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01444.90
Common NameJCGZ_25006
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 260aa    MW: 30034.9 Da    PI: 8.0685
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01444.90genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.77.3e-301165155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   k+rlrWt+ LH+rF  av+qLGG+++AtPk il++m+ +gLt++hvkSHLQkYR+
  Jcr4S01444.90 11 KERLRWTQPLHDRFEMAVNQLGGPDRATPKGILKAMSTPGLTIYHVKSHLQKYRI 65
                   68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.9E-28966IPR009057Homeodomain-like
SuperFamilySSF466894.48E-161065IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-231166IPR006447Myb domain, plants
PfamPF002491.5E-61364IPR001005SANT/Myb domain
PfamPF143799.9E-1997139IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MASSRADASG KERLRWTQPL HDRFEMAVNQ LGGPDRATPK GILKAMSTPG LTIYHVKSHL  60
QKYRISKFIP ESNNKGKLER RNISELLPNF GTTSAAQLNE ALQMQMEVQR RLSDQLEVQK  120
NLKAKIEAQG RFLDRIVVEH RNRPMNVRKH NKSSFSTSLP SLCDESESNY SKEFESYTEN  180
IDRVENEIQC EQDDEFQALK RLRTENDVLP LRYKLEQLNS DPYSNLQNMI YERDDAKFSN  240
NIDLPWSSPS CSLPLLPSFL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088020.11e-175PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A067JKM40.0A0A067JKM4_JATCU; Uncharacterized protein
STRINGPOPTR_0006s10190.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106592535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.13e-50G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]